10 Best Migraine Hats To Save You From Debilitating Migraine Pain

10 Best Migraine Hats To Save You From Debilitating Migraine Pain


Migraine is "more than just a headache." What do you do when a migraine hits you? Probably run for ice to dull the pain? We resort to a lot of home remedies to get rid of that throbbing or pulsing pain . Some people fashion their cold compress by putting ice in plastic bags while others may apply a frozen gel pack over their heads. All of this requires a little more effort – which might not be possible when we are brain fogged

The imminent mess also adds to the agony! Sometimes, you wake up to a soaking wet bed if the plastic bursts. Also, you can not go anywhere while you are icing – and that inhibits your mobility. To address all these issues, we have the migraine hat. A migraine hat is an ingenious product designed to help those who get debilitating migraine pain. We have compiled a list of the top 10 migraine hats to help you out.

Here's how migraine hat works

A migraine hat or migraine band is a handsfree and soft adjustable band that wraps around your head. The ice gel pack is placed inside the band – which is also long enough to cover your head. It is adjustable, which means you can loosen or tighten it to target the pressure points. The cold and compressing therapy provided by the migraine hat has a numbing effect that helps reduce pain sensation

As already discussed, the hassles with DIY ice hats are many. Another major problem with DIY ice packs is that they obstruct fingertip compression. Migraine hats claim to solve this problem by allowing you to adjust the level of compression. If you have responded well to cold or compression therapy in the past, you have reasonably good reasons to try the migraine hat

Here are the 10 best migraine hats that can provide relief from the pain

10 Best Migraine Hats

1. Headache Hat-The Original Wearable Ice Pack for Migraine Headaches and Tension Relief

 Headache Hat-The Original Wearable Ice Pack for Migraine Headaches and Tension Relief

The original headache hat, also known as the headache halo, is made of 92% cotton and 8% lycra. It provides rapid and long-lasting cooling therapy for migraine headaches. It also works well for head and neck stress. This headache hat is made of soft material, such as cotton, spandex, and microfleece, and is comfortable to wear for long hours (including during travel). The ice cubes are coated in thin plastic layers to give you lasting relief without having the ice melt on you. This hat has a flexible design; you can move the ice cubes within the band and target all the pain points on your head and body

Pros
  • Made of soft and comfortable material
  • Provides instant and long-lasting cooling therapy
  • Flexible design
  • Can be used as an eye mask, neck pillow, etc.
Cons

None

Rating

4.5 / 5 [19659902] Buy it now! Headache Relief Ice Pack Hat

 Headache Relief Ice Pack Hat

The headache relief ice pack hat from World-Bio is a flexible gel-ice head-wrap. This cool hat is made of soft, flexible material, and you can wear it comfortably for long hours. The hat perfectly contours your head. It stays secure with no need to readjust repeatedly. This migraine hat is leakproof and latex-free. The gel packs remain mouldable even when frozen.

  • Long-lasting gel
  • Moldable
  • Convenient size
  • Reusable (both hot and cold)
  • Rating

    4.5 / 5 [196590021]

  • Headache Hat-Go Ice Pack For Migraine

     Headache Hat-Go Ice Pack For Migraine

    This ice head wrap is made of soft and flexible material like cotton, spandex, and microfleece – making it comfortable to wear for long hours and even while traveling. The individually wrapped ice cubes move easily and can be adjusted to target pain points and provide instant cooling sensation. This lightweight band can be worn in multiple ways.

    • Soothing compression
    • Long-lasting cooling therapy
    • Flexible design
    • Soft and comfortable material
    Cons

    None

    Rating

    4.4 / 5

    Buy it now! Arctic Flex Headache Relief Ice Pack Hat ” width=”700″ height=”450″ />

    The Arctic Flex Headache Relief Ice Pack Hat

     It has two snap buttons to prevent the ice from shifting. This ice pack hat has a stretchable cover that has a maximum head circumference of 24 ". This wrap also includes a extender strap that extends to 30 "in circumference. It is leakproof and latex-free. This migraine hat comes with a 60-day unconditional guarantee that helps you make a confident purchase </p>
<h5> Pros </h5>
<ul>
<li> Targeted migraine relief </li>
<li> Customizable for hot or cold treatment </li>
<li> Adjustable fit with extender strap </li>
<li> washable cover </li>
<li> 60-day guarantee </li>
</ul>
<h5> Cons </h5>
<p> None </p>
<h5> Rating </h5>
<p> 4.3 / 5 [19659902] <a href= Buy it now! Icekap Migraine Cap

      Icekap Migraine Cap

    The Icekap Migraine Cap is the first of its kind. It is supported by the National Children's Cancer Society and recommended by MDs. What makes it unique is the soft micro fleece and the adjustable occipital tension band. It allows your head to melt into the fabric and also creates the correct compression. The Icekap Migraine cap has 5 treatment-grade non-toxic gel ice packs. These gel packs stay cool for longer and remain soft when frozen. Icekap migraine cap provides full coverage to the occipital area and the neck. It also covers the crown, temporal, parietal, and frontal regions

    Pros
    • Adjustable occipital tension band
    • Remains soft when frozen
    • ] 19659018] Custom
    Cons
  • None

    Rating

    4.3 / 5 [196599021] Buy it now! Magic Gel Migraine Relief Cap ” width=”700″ height=”450″ />

    This Migraine Relief Cap is made of a PVC and nylon exterior with a soft lycra layer. The inside of the cap is made of a mixture of water, glycerol, SAP, and Korean clay to provide long-lasting coolness. It remains soft and flexible even at low temperatures. It creates a calm, cool, and dark environment.

  • Compositive fit
  • Drug-free
  • Provides 35 minutes of cold relief
  • Reusable up to 300 cycles
  • The magic gel migraine relief cap is drug-free and recommended by neurologists. Comes with multiple fitting options
  • Leakproof
  • Cons
    • Not adjustable
    Rating

    4.3 / 5 [19659902] Migraine Gel Ice Hat – Fomi Care

     Migraine Gel Ice Hat - Fomi Care

    Fomi's Migraine hat is made of soft fleece material and is lightweight. This ice hat comes with three removable and reusable gel packs – two to cover each side of the head and one for the front, giving you full coverage. It gives an instant cooling sensation and provides soothing relief by targeting all the pain points in your head. It reaches deep into the tissue to diminish the pain and stays in place, creating a hands-free experience. You can put either the entire migraine hat or just the gel packs in the refrigerator or freezer to achieve the desired temperature for cooling. It is made of a non-toxic medical-grade liquid gel.

  • Reusable
  • Safe to use
  • Cons
  • Cons
    • 19659013]
    Rating

    4.2 / 5

    Buy it now

    8. Aroma Seasons Ice Cold Pack For Migraine ” width=”700″ height=”450″ />

    Aroma Seasons Ice Cold Pack For Migraine ” width=”700″ height=”450″ /> Aroma Seasons Ice Cold Pack For Migraine It covers your entire face – the skin around your face – except for the nose. It comes packed with 9 gel packs individually in 9 separate pockets, and they can be adjusted to target the pain points. This provides optimal comfort. You get one extra gel pack with this cold pack. This migraine hat helps relieve not only migraine and headaches but also facial swelling, aches, or strains. It is designed to cover the whole head and leave no pressure on the nose

  • Designed with Velcro closure
  • Buy it now !

    9. The Sinus and Migraine Cap – MARS Wellness

     The Sinus and Migraine Cap - MARS Wellness

    This slender cap is designed to cover your sinus, temples, eyes and neck area. It stimulates acupressure points around the sensitive eyes and neck. The cap is suitable for people with migraine, headache, and face swelling. It can be used for both hot and cold therapy. This is an all-natural product made of 100% natural herbs and flax seeds

    • Pro
      • Adjustable design
      • All-natural product
      • Extremely lightweight
      • Cooling does not last long
      Rating

      3.9 / 5

      Buy it now! The Migraine Hat – Wearable Ice Hat

       The Migraine Hat - Wearable Ice Hat

      This wearable ice hat is made of comfortable fabric and is lightweight. Its clever design makes it really look like a real wrap or hat. This cryo gel ice pack has individual ice cubes for acupressure. It is adjustable and helps to target pressure points and create compression. It contours your head completely and stays secure in place.

                Rating

                ] 3.8 / 5

                If you are considering adding a migraine hat to your anti-migraine arsenal, please keep in mind a few points before you click on the buy button.

              • Points to Consider While Shopping For A Migraine Hat
              • Check the material of the hat. For example, if the hat is made of a spandex (which is a lightweight synthetic fiber), the pressure applied will be less.
              • Go for latex-free ice pack wraps if your body's immune system overreacts to the proteins found in natural rubber latex allergy
              • Choose a hat that will contour the circumference of your head and will stay sturdy
              • The cold hat should be able to provide you with instant and long-lasting cooling. ] The hat should be drug-free

              These are the 10 best migraine hats available on the market right now. If you have a comforting experience with a cold compress or ice therapy during your migraine blues, you should probably consider buying one of these. Remember, it is better to seek professional help if you are grappling with migraine.

              The post 10 Best Migraine Hats To Save You From Debilitating Migraine

              Pain first appeared on STYLECRAZE .

    6 Things A Bride MUST DO Before Getting Married

    6 Things A Bride MUST DO Before Getting Married


    He grew up, everything we had to imagine for adulthood was getting married and having children up to 30 years of age. Of course, being able to do this is like reaching a cornerstone in a person's life. But when we are close to this phase, the terrible phase of marriage, we are becoming more and more aware that we are inclined to turn back into a cocoon for regret, to things that are rejected and unspoken before embarking on a journey of military life. You know, we are talking about the final #bucketlist that needs to be checked before we say "I do" in my life. Often the deafening brouhaha, who is holding on to finding "" and getting it, makes us forget to focus on the great things we wanted to do for ourselves.

    That's why we think that every bride-to-be and every woman there should have a list of preborn buckets. And as Mark Twain rightly said, " In twenty years, you will be more disappointed with the things you have not done than with those you have done. So throw away the line. Say away from the safe harbor. Grab the sail in your sails. Research. Dream. Discover. "

    So here's a list of buckets we've organized for you all you have to do before you go along the path with your man.

    1. Make sure you're knit forever a circle friend

      Make sure you knit A Forever Friend Circle

    Shutterstock

    True when they say, "Friends are Forever!" Your life definitely can not be anything that happens in their absence, is it? So make sure you mix and attend social gatherings. Find yourself friends who will stay around no matter what. Find a group of friends that can be your 3 AM buds, find some with which you can go to those night outings and parties to find some with which just coffee is as a holiday on its own. Having close friends around you will not only keep your individual spirit alive, but if they are around you will have your share of teachings and conversions. So build friends and stick to them because they will be your strength forever.

    2. Take, Em, Degrees to Your Name

      Get, Em, Degrees to Your Name

    Shutterstock

    Academic aspirations are also part of your life! So find out which course suits your brain most, register for it, and achieve that degree. If you like to study, continue to do it even after your marriage. We are sure that your husband and relatives will be proud of such achievements in their lives. Because education, dear ladies, is everything!

    3. You have to get into a life-giving relationship with yourself

      You have to enter into a life-giving relationship with yourself

    Shutterstock

    When you live with your parents or guardians, you are always protected; you will not feel how your mind, heart and body would react to situations when you have to deal with them yourself. And marriage, on the contrary, is all this – the way you can handle the new connections, the new challenges, the new circumstances that you will face for the first time. So get out of your house, even if it's only for a few days. Feel the limitless freedom and the challenges that come with it. Understand yourself; love yourself better before sharing your life with another person.

    4. Travel: Provides you with a lifetime experience

      The trip gives you a life experience

    Shutterstock

    Is there a long weekend? Just pack your bags and go on an extroft trip. Go to solo trips or go with your besties, but just go! The journey enriches your inner self with experiences. New places, culture, food, music, people – all will free you from the stress of life and teach you new things. Take a journey log or diary and start writing your memories. The journey makes two things for you, you create memories that you will remain dear to yourself for ever, and you are studying new things that will redefine you as a person.

    5. Write what you always wanted to do

      Record what you always wanted to do

    Shutterstock

    Maybe you always wanted to go to a hot air balloon in Turkey or go to Everest base camp or just just wanted to visit at least one country on every continent. All such desires or dreams, record them. Then start marking them one at a time. You do not have to always wait to go there with your partner. You can go alone, go with a stranger or with your family. Make sure you've done what you've always wanted.

    6. Invade yourself

      Spread yourself

    Shutterstock

    A few years before your marriage is the time you have to love yourself the most. Pamper yourself, do whatever holds you happy. Go shopping. Take a picture of yourself. Spend time with your family if that's the happiest one. Ask them also to pamper you. The ability to learn and evaluate yourself will also help your husband do the same with you. Become comfortable in your own skin and then manage the world with your charm.

    If marriage negotiations have already begun in your home, then it is high time to pass a death list with a bucket like the one above and start writing things out of it. What else do you think you should go to this bucket list? Let's know in the comments section below

    The Fast 6 things the bride must do before she marries appears first on STYLECRAZE .

    Trendy Things It’s Time To Say Good-Bye To

    Trendy Things It’s Time To Say Good-Bye To


    Changing is inevitable and this is true of the world of fashion. No matter how vicious and even a revolutionary trend happens, it will eventually fade away. These trends can come back alive from their graves in decades, but this is a brand new story that you can read in our previous article . From now on, you will have to say goodbye to your favorite fashion items, because it has existed for some time.

    This decade has seen many trendy trends literally "trend" and thanks to social media platforms like Instagram to make them so popular. The obsession with thick eyebrows and naked makeup are things we know through social media more than any fashion show or film. Now, however, it is time to say goodbye to most of these elements because they are approaching the dawn of their glory. Let's take a look at some of these fashion trends, which have been extremely popular over the past few years, but will soon disappear.

    Clocks with Metal Strips

      Metal Watches

    Shutterstock

    The Clock is Finished! Metal watches were a huge thing for this decade. People said goodbye to their funky clocks of straps and leather straps, and from their hearts moved to the metal that looked more elegant and simple. Well, the next generation trend will be all about natural makeup and accessories that are extra. So, it is quite clear that flowers and leather clocks with an internal model dial will soon reign. Instagram Eyebrows ” width=”700″ height=”450″ />

    Shutterstock

    Instagram Eyebrows ” width=”700″ height=”450″ />

    Shutterstock

    A thick and well-cleansed eyebrow is the dream of every woman today – or perhaps to this day. These too dense, similar to the airbrush eyebrows are too much to take and women are now turning to a lighter eyebrow makeup. The new eyebrow trend, which is likely to replace "Instagram Eyebrows," is naturally fat and straight. While the current trend requires female eyebrows to be arc-shaped, the next one will be for slightly curled, almost eyebrows. Crystal Sunglasses are a muse for some people a few months ago, but they are almost on the verge of extinction today. ” width=”700″ height=”450″ />

    Sunglasses with crystals ” width=”700″ height=”450″ />

    Shutterstock

    They no longer look chic and glamorous, but only sticky and inexpensive. The characteristics of the sunglasses you will need to look for this fashion season will be the shapes of the frames and the nuances of the glasses. Long nails

      Long nails

    Shutterstock

    Nails have been something that people have attached so much importance over the last decade. Nail and manicure studios would have earned enough lifetime for the past few years. We saw celebrities such as Bela Hadid and Blake Lively to wear long claws at Met Gala last year, but this is probably the only place we will see extra long nails in the future. Women prefer shorter and simpleer manicures that do not require too much support

    Heavy Art ” width=”700″ height=”450″ />

    Shutterstock

    Nail art is a concept that became extremely popular in the 2010s. We agree that they are really beautiful and provide a very wide range when it comes to different projects. But this ship sailed. In 2019, you will see very few people who spend their time and money on these designs. At some level, they were always ridiculously expensive and uncomfortable to wear, but people could not just overcome how beautiful they were. Well, now the same people are almost over these "heavy" nails

    Pajamas style clothing

      Pajamas style clothing

    Shutterstock

    Sweetheart swimsuits are sweet but will not last long. The "cute" dressing pattern, which shows tight bunnies and emotions of clothing and accessories, probably originates from countries like South Korea and China. This trend spread like a fire through online shopping websites and soon became a global trend. However, this will not continue as we move to a whole other era of fashion (as always). [196590029] No accessory style

      No accessory style

    Shutterstock

    Accessories are the only things that swim the waves of the upcoming trend. While clothes and makeup will be much simpler than the trends so far, accessories will be key highlights. Huge necklines, bracelets and earrings will be developing this season. Chokers

      Chokers

    Shutterstock

    Chokers became faster than the internet sensation Priya Varrier. From college to supermodels, everyone began to wear jokers with different colors and patterns throughout this decade. Although these accessories crawled back from the dead, it is time to send them back again. Do not worry if you are a choker lover because they can come back in a few years.

      Shoulder-cut tops

    Shutterstock

    and dresses do you have in your wardrobe? Let us admit that we all bought a lot of them last year when they were on top of their glory. Now the cut shoulders are almost dead and we can not even see anyone wearing them. That's over people, cover your shoulders now!

    No matter how astonishing thing you see and how modern this happens, it will not go on. But hey! There are better things that come your way and get ready to be in style. Which was your favorite fashion trend over the last decade? Which of them do you expect to attract next season? Let him know in the comments below. The fast The fast The fast The first time STYLECRAZE

    10 Best Teeth Whitening Products For Pearly White Teeth – Buying Guide And Reviews

    10 Best Teeth Whitening Products For Pearly White Teeth – Buying Guide And Reviews


    Do you know that your mouth is home to billions of bacteria? While most of them help digestion and protect your teeth and gums, a few of them can also cause cavities. Regular practice of good oral hygiene – like proper brushing, flossing, and rinsing – will prevent gum disease, tooth decay, and plaque

    Another telltale sign of unhealthy oral hygiene is stained or yellow teeth. If you are a regular coffee, tea or wine drinker, you must be familiar with this. These stubborn stains leave a yellowish hue on your teeth and produce bad breath. If you have stained teeth and are looking for a quick solution to get rid of them, we suggest you take a look at our 10 best whitening teeth products. To help you find the right product that suits your needs, we have included a mix of teeth whitening kits, LED teeth whitening devices, gels, pens, and more

    Note: Along with these teeth whitening products, we suggest you cut

    Top 10 Teeth Whitening Products To Buy In 2019

    1. Active Wow 24K White Activated Coconut Teeth Whitening Charcoal Powder

     Active Wow 24K White Activated Coconut Teeth Whitening Charcoal Powder

    Are you looking for ways to remove bad breath and eliminate stains caused by coffee and tea? Try Active Wow 24K White Charcoal Powder. With just one dab and brush stroke, this powder claims to leave your teeth whiter. It is the best way to detoxify your mouth. It contains activated coconut charcoal that quickly polishes away stains and leaves your teeth looking clean and healthy.

  • Hassle-free
  • Purifies and detoxifies
  • 19659010] Long-lasting effects
  • Removes coffee, tea and cigarette stains
  • Cons

    None

    Ratings

    4.7 / 5 [19659902] AuraGlow Deluxe Home Teeth Whitening System ” width=”700″ height=”450″ />

    This teeth whitening kit delivers dental-grade results right at home. The system uses LED whitening technology combined with a high-quality teeth whitening gel that helps wipe away stains caused by coffee, tea, aerated drinks, and smoking. The LED uses light-fast whitening technology to activate the molecules in the whitening gel. This will accelerate the whitening process during each treatment by three times. Other features like five built-in bulbs, a 10-minute built-in timer, and a comfit-fit tray are also present

    Pros
    • Safe for enamel
    • No sensitivity
    • up to 20 days
    • Fits any mouth
    • No molding required
    • No side effects
    • No
    • 19659017] 4.7 / 5

      Buy it here! Cali White Activated Charcoal & Organic Coconut Oil Teeth Whitening Toothpaste

       Cali White Activated Charcoal & Organic Coconut Oil Teeth Whitening Toothpaste

      If you are looking for a teeth whitening solution that is economical and easy to use , try Cali's White Activated Charcoal & Organic Coconut Oil Teeth Whitening Toothpaste. It is one of the most effective whitening and detoxifying products out there. The formula is infused with antiseptic and remineralizing properties of diatomaceous earth, tea tree oil, coconut oil, xylitol, and peppermint oil

      Pros
      • Free of fluoride and peroxide
      • Safe for kids
      • Does not cause sensitivity
      • Deliver results within 1-2 weeks
      • Very refreshing
      Cons

      None

      Ratings

      4.6 / 5

      Buy it here!

      4. Crest 3D Whitestrips Dental Whitening Kit

       Crest 3D Whitestrips Dental Whitening Kit

      Crest 3D Whitestrips Dental Whitening Kit contains 28 enamel-safe white strips. They claim to deliver professional-grade teeth whitening results in just a couple of weeks. The best part about this product is that the results last up to 12 months. The advanced seal technology ensures that the white strip stays in place without slipping. The strips mold to the shape of your teeth perfectly and come off neat and clean. 19659010] ADA-approved

    • Removes 10 years of stubborn stains
    • Allows you to carry out regular activities such as talking and drinking
    • Slip-free design
    • Easy to use
    Cons [19659909]
    Ratings

    4.6 / 5 [19659902] Buy it here! SenAllis Cosmetics Teeth Whitening Gel ” width=”700″ height=”450″ />

    This unique teeth whitening gel can be used with or without a mouth tray. You can use it either with your teeth whitening tray or just like toothpaste and brush your teeth. The formula helps break down the chemical structure of the stains on your teeth and makes them whiter than ever. The pack includes four syringes with 10 ml gel in each. It claims to remove years of stains in limited sessions.

  • Very easy
  • Very good
  • A short product
  • Delivers immediate results
  • Cons

    Rating

    4.5 / 5

    Buy it here!

    6. Crest 3D White Brilliance 2 Step Toothpaste

     Crest 3D White Brilliance 2 Step Toothpaste

    Crest's new White Brilliance 2 Step Toothpaste cleans and whitens your teeth with daily use. It is a convenient 2-step system that polishes your teeth and freshens your mouth. Besides whitening your teeth, it helps prevent gingivitis and cavities

    • Easy to use
    • Reasonably priced
    • Premium grade ingredients
    Cons
    • 4.4 / 5

      Buy it here! AsaVea Bright White Teeth Whitening Pen ” width=”700″ height=”450″ />

      This professional teeth whitening pen contains 35% Carbamide Peroxide, which helps eliminate stubborn stains caused by smoking and drinking coffee, wine, or soda. Its natural mint flavor will help prevent bad breath. The pen is equipped with a user-friendly twist mechanism, which reveals a soft brush tip. Using this brush, you can gently paint each tooth for an effective whitening experience. Another convenient feature is that the transparent tube will allow you to see how much product is left in the tube. With just 1 minute of daily use, this ultra-safe pen provides quick results in no time.

    • Safe to no
    • No sensitivity
    • Travel-friendly
    • Safe and no side effects
    • Contains 20 + uses
    • Free of harsh chemicals
    Free of harsh chemicals
    Poor design
    Ratings

    4.3 / 5 [196599021] Opalescence Whitening Toothpaste

     Opalescence Whitening Toothpaste

    Opalescence Whitening Toothpaste is a handy product for maintaining a bright and white smile. It removes the surface stains and lightens your teeth up to two shades in just a month. The cool mint flavor refreshes your mouth. This is a toothpaste that is safe for all age groups as it is free of harmful chemicals such as Triclosan and fluoride

    Pros
    • No sensitivity
    • Delivers quick results
    • Affordable
    Cons
    Ratings

    4.2 / 5

    Buy it here! Bee Naturals Whitening Pre-Brush Oral Rinse ” width=”700″ height=”450″ />

    Bee Naturals Whitening Pre-Brush Oral Rinse

      It contains 3% Hydrogen Peroxide, chlorophyll, xylitol, and natural spearmint oil. These ingredients whiten your teeth gently and neutralize bad breath. They leave a refreshing, natural mint flavor post-rinsing. </li>
<li> Easy to use </li>
<li> Free of artificial preservatives </li>
<li> No flapping sensation </li>
<li> </li>
</ul>
<h5> Cons </li>
</ul>
<h5> Expensive </li>
</ul>
<h5> Ratings </h5>
<p> 4.2 / 5 </p>
<p> <a href= Buy it here! Dr. Brite Stain B-Gone Natural Teeth Whitening Pen

     Dr. Brite Stain B-Gone Natural Teeth Whitening Pen

    Dr. Brite Stain B-Gone is a portable teeth whitening pen that claims to give you five shades of brighter and whiter teeth. It contains cranberry seed oil and chamomile flower extract that whiten your teeth naturally without causing sensitivity. (196590010) Free of harmful chemicals

  • No artificial flavors or colors
  • Can take up to 40 applications [19659010]
  • Expensive
    Ratings

    4.1 / 5

    Buy It Here! fix your stained teeth in your bathroom. But, the question is, how do you choose the ideal product?

    Purchasing Guide For Teeth Whitening Products

    1. Quality

    While buying a teeth whitening product, you need to keep two main points in mind – the ingredients and the effect. Look for a product that clearly labels its ingredients and research what ingredients are harmful to your teeth before selecting one

    2. Ease-Of-Use

    Since we've all been busy with our hectic lives, a complicated device is the last thing we need. So look for a product that fits into your rushed life. Whitestrips, toothpaste, whitening gel pens are some of the best easy-to-use tools

    3. Brand

    Not only functionality, but the brand also matters. Pick a product that offers assured warranties with recognized certifications.

    4. Price

    This depends on the type of product you choose. If you are looking for simple teeth whitening tools such as toothpaste, charcoal powders, and pens, they do not cost a bomb. But the high-end device is a bit more expensive

    5. Pain

    If you have sensitive teeth, avoid using cold whitening gels as they cause more pain and cause harm to your gums

    Since teeth whitening does not happen overnight, you can consider these points to accelerate the process. ] How To Get Whiter Teeth Quickly

     How To Get Whiter Teeth Quickly

    Shutterstock

    1. Keep A Check On Your Dental Hygiene

    Rinse your mouth after every meal. Use portable teeth whitening products like stripes or whitening gel pens so you can carry them to your office or anywhere. Replace a soft toothpaste with a whitening toothpaste. Includes an oral rinse in your morning dental routine.

    2. Consult A Dentist

    If the stains will not go away, consult a dentist immediately and ask for a thorough cleansing treatment. Brush And Floss Regularly

    Healthy gums lead to healthy and bright teeth. Brush your teeth and floss twice a day to get rid of the hard-to-reach plaque that makes your teeth yellow

    Keep the above points in mind and pick the best teeth whitening product from the list for you.

    Expert's Answers For Readers' Questions

    Can I Use It During Pregnancy

    During pregnancy, it is safe to use any product that may come with caution. However, we recommend you consult your doctor before using a teeth whitening product

    How often can I whiten my teeth

    If you are opting for teeth whitening products, it is safe to use them once a day. However, using them more than twice can lead to tooth sensitivity The post 10 Best Teeth Whitening Products For Pearly White Teeth appeared first on STYLECRAZE .

    21 Best Compliments Men Would Love To Hear

    21 Best Compliments Men Would Love To Hear


    Ever felt two inches taller after receiving a cute compliment? For girls, it's a cakewalk. However, complimenting a man is a bit more difficult than we would have expected, is not it? It's a challenge to understand what will boost his confidence and make him happy. Though most men appear to be the epitome of content and self-love, and a sincere compliment can make their day brighten

    Here are 21 easy ways to compliment your man, which he will not be able to resist and make him fall head over heels for you all over again

    1. "I believe in your dreams."

     I believe in your dreams

    Shutterstock

    It is sometimes difficult to understand what goes on in the secretive mind of a man who does not share much of his thoughts. Be the cheese to his crackers and say out loud that you believe in his dreams. A little pat on his shoulders and the assurance that you trust him and the plans he has for you both will get him smiling in no time

    2. "You keep me super happy."

    Little efforts are all to be happy. But have you really expressed the joy he brings to you with his endeavors? Appreciate the tiny baby steps he takes, be it opening the door for you, remembering to order your favorite snack before you are hungry, or just smiling when you look at him. It is very important to remind your confused teddy with a tight hug how happy they make you

    3. "You look amazing!"

    You probably underestimated the time he allotted to his perfectly lined shave, haircut, and spa every month. He probably looks in the mirror more than you do! A little appreciation of his visible changes like his abs or his new hairstyle, will make him feel cared for and loved

    4. "You make me feel like home."

    Home is where is peace and warmth. Nothing can feel more warm and loving as being called someone's happy home. Tell him he makes you feel so comfortable that you are able to be yourself with him. Give him the calmness he admires and let him know the teddy bear fuzzy warm feeling that you love about him

    5. "You are incredibly funny!"

     You are incredibly funny

    Shutterstock

    Remember the silly joke he cracked to bring a smile on our face? The tiny efforts he makes to make you giggle are just adorable. Men often like to be acknowledged for their humor and how they trigger your funny bone. Behind him and let your laughter be the most encouraging in the group

    6. "I love your style."

    Not all men walk around in sweatpants and tracks. Some are aware of which color suits them most and which shirt makes their tummy look flat. They may also take a lot of effort to get ready for a date with you. Such endeavors should not go unheeded. Look at him all sparkly eyed and tell him he could give a tough competition to Brad Pitt any day

    7. "I will always have your back, no matter what."

    Sometimes, all he needs is a steady hand to hold on when he is faltering. Even though men are expected to be the strong pillars of support, it is very important to let them know that no matter what, you will always be the one standing beside them, through thick and thin. Be his partner for life and see the strong foundation of your relationship blossom

    8. "You are the one I always wanted!"

    When we see them do something super cute, we are often grateful and thankful to the universe for sending them our way, but did we actually tell them? Sometimes they try harder than we think to get our attention and feel loved. Telling them that they are Mr.

    9. "I'm in love with everything you do for me"

     I'm in love with everything you do for me

    Shutterstock

    No matter how easy or effortless it looks, men do go through the same emotional turmoil women go through. The way he cooks scrambled eggs for you or makes sure you do not get cold should not go unnoticed and unappreciated. Compliment him for all that he has accomplished and what he goes through every day to keep the smile on your face intact.

    10. "I love you just the way you are."

    It is not always easy to accept someone as they are. Yes, he is not perfect. He has flaws. And so do you. Acceptance is the key to a happy relationship. Tell him he is what you need to be happy and that you adore him and he fell in love with what he is.

    11. "I really love how you make me feel special."

    We often envy how well other women are treated by their men and take the efforts put by our men for granted. If he waits to pick you up from work, be thankful. Thank you for every little thing he does for you and make him feel special as he makes you feel

    12. "You inspire me to look beyond the obvious."

    Having a soulmate for a partner is a boon. However, sometimes, you have to keep your horizons wide open and give him the opportunity to express his thoughts. It might not be the same way you think, but it will help you understand him better. Remind him that you like the way he thinks differently and how he has opened the door to your ways of perceiving things

    13. "You look really good!"

     You look really good

    Shutterstock

    Do you remember checking him out of the head to the moment he bent down to tie his laces? And you liked what he was wearing? Well, the style does not fall from the sky, and he probably spent quality time thinking what to wear, which shoes to go with them, which deodorant would impress you, and which hairstyle would make you go nuts for him. Tell him he looks really good and you love the way he dresses. Such compliments affect men more than we think they do.

    14. "Times spent with you are the favorite part of my life."

    Ever baked a cake together? Or maybe wrote Christmas cards together? No matter how tiny work you both engage in, it's always fun when you do it as partners. Tell him that times spent with him are your best memories

    15. "You are so easy to talk to."

    Building a comfort level with someone is not as easy as we think it is. Opening up to someone is even more challenging. One of the greatest compliments you can give is that you feel free to be with him and that he helps bring out the real you

    16. "You are my favorite super chef!"

    Men who cook often take a lot of effort in the cooking and presentation to make sure you go mmmmmm … yummmmm in your tummy. Applaud him for his Master Chef-winning recipe. It is always fun if you cook together. It's either a delicious outcome, or you have fun messing up together.

    "You make me feel like a queen"

     You make me feel like a queen

    Shutterstock

    It's him opening the pickle jar because it was too tightly jammed for you to open, or him holding the umbrella for you in the downpour and preventing you from getting drenched – thank him for all he does to treat you like a queen

    18. "You're a good man, and I'm proud of you."

    Remember the time we were given treats and candies every time we did something good? We grew up, right. But men have just little boys who grew long limbs and legs (lol). It is your duty to pat the big boy every now and then and tell him what a good boy he is and that he makes you a super current

    19. "I trust you – completely."

    Trust is the foundation of any relationship. Tell him you trust his values ​​and choices in life. Compliment him on his judgment and decision-making abilities. Make it aware that you look for him for good advice on anything about your life or relationship

    20. "You've changed my life for the best."

    Self-doubt is more dangerous for your man than you thought it was. The tiny person inside the big man can lock himself up completely if he feels he is not good enough for you. Tell him how important he is to you and how he has changed your life for the best, and he will probably let the tiny little man inside him free again

    21. "I love hanging out with you – even if we're doing nothing."

     I love hanging out with you even if we are doing nothing

    Shutterstock

    Remind him that his company is the best gift he could give you. Let him know that you would rather stay cuddled beside him than go to the most exciting place with anyone else.

    Make your guy feel like a hero sent right out of the Marvel universe, and he's bound to blush and give you the cheeks kiss that you love so much. Keep him happy with compliments and see how the big boy welcomes you deep in his heart with open arms. It is as important for him to feel pampered and appreciated as it is for you.

    The Post 21 Best Compliments Men Would Love To Hear appeared first on STYLECRAZE .

    10 Best At-Home Chemical Peels To Try In 2019

    10 Best At-Home Chemical Peels To Try In 2019


    Gone are the days when we had to run to the aesthetician to get a chemical peel done. Today, you can easily get a chemical peel done at your home. Chemical exfoliators or chemical peels are fast replacing physical exfoliators (like scrubs). They provide more exfoliation than physical exfoliators and improve skin texture. Compared to professional peeling, at-home chemical peels are mild and easy to use. If you are contemplating diving into the world of at-home chemical peels, here are the best products you can start with.

    Top 10 At-Home Chemical Peels

    1. The Ordinary AHA 30% + BHA 2% Peeling Solution

     The Ordinary AHA 30% + BHA 2% Peeling Solution

    Product Claims

    This is a cult favorite for all those who swear by chemical peels . This 30% AHA and 2% BHA formula combines three acids – lactic, salicylic, and glycolic acids. It is a 10-minute exfoliating peel that helps to reduce spots and blemishes and appearance of lines and improves your skin texture with continued use. It is suitable for normal, oily, and combination skin types.

    Note: This product does not come with any safety seal or plastic wrap.

  • No formaldehyde or formaldehyde-releasing chemicals
  • No longer available
  • No features available. (19659010) No
  • No harmful chemicals
  • No harmful chemicals
  • Safe for skin
  • Cons [19659023] 2. Caudalie Glycolic Peel [19650024] Caudalie Glycolic Peel ” width=”700″ height=”450″ />

    Product Claims

    Want radiant skin in just 10 minutes? This is the product for you. It claims to shine your skin and make it smooth and glowing in only 10 minutes. It contains glycolic acid and exfoliates your skin gently and refines its texture.

  • No synthetic chemicals (parabens, anti-inflammatory, anti-inflammatory, SLS, SLES, formaldehyde, etc.)
  • Vegan formula
  • No-toxic
  • No animal derived ingredients
  • Cons [19659906] None

    ] Buy it here

    3. Paula's Choice RESIST Advanced Smoothing Treatment

     Paula's Choice RESIST Advanced Smoothing Treatment

    Product Claims

    This is a cocktail of three acids – lactic, glycolic, and malic acids. It has a super concentrated formula. Besides acids, it contains essential ceramides, peptides, licorice extracts, and allantoin that keep your skin smooth and prevent further environmental damage.

  • Paraben-free
  • Sulfate-free (Leaping Bunny certified)
  • pH-adjusted
  • free
  • Cons

    None

    Rating

    5/5

    Buy it here! Lancer Caviar Lime Acid Peel ” width=”700″ height=”304″ />

    Product Claims

    If your skin is dull and stressed, you can try this product. It contains 10% AHA, which is derived from Caviar Lime, and Australian fruit, which is rich in natural AHAs. It contains glycolic acid, phytic acid, retinol, and enzymes derived from pineapple and papaya that help resurface your skin, refine skin pores, even out the skin, and minimize lines and wrinkles to deliver baby soft skin

    Paraben-free
  • Sulfate-free
  • Phthalate-free
  • Developed by dermatologists
  • Cons

    None

    5/5

    19659023] 5. Dr. Dennis Gross Skincare Alpha Beta Universal Daily Peel

     Dennis Gross Skincare Alpha Beta Universal Daily Peel

    Product Claims

    This daily peel formula targets three signs of aging – uneven texture and skin tone, fine lines and wrinkles, and open skin pores. This chemical peeling formula is a combination of five acids that nourish your skin and provides anti-aging benefits.

  • Sulfate-free
  • Phthalate-free
  • Cruelty-free
  • This is a pre-soaked pads and is ideal for anyone new to at-home chemical peeling. Vegan
  • Suitable for all skin types
  • Cons

    None

    Rating

    5/5

    Buy it here! Amorepacific Treatment Enzyme Peel Cleansing Powder

     Amorepacific Treatment Enzyme Peel Cleansing Powder

    Product Claims

    This is a water activated exfoliating powder. In other words, you have to wet your face and then use this powder to wash your face.

    Pros
    • Contains probiotic enzyme (Lactobacillus ferment)
    • Sulfate-free [19659010] No formaldehyde-free agent
    • No formaldehyde-free agent
    • No formaldehyde-free agent
    • Rating

      5/5

      Buy it here! Tata Harper Resurfacing Mask ” width=”700″ height=”450″ />

      Product Claims

      This is a BHA skin mask and especially suitable for dry and combination skin types. It contains natural BHA derived from white willow bark. It exfoliates your skin surface and minimizes the appearance of the pores. It also contains pink clay extracts that remove excess oil and keep your skin pores clean

      Pros
      • 100% natural formula
      • Paraben-free
      • Formaldehyde free
      • ] Mineral oil-free
      • Sulfate-free
      • No synthetic fragrances
      Cons [196590010] None

      !

      8. Drunk Elephant TLC Sukari Babyfacial

       Drunk Elephant TLC Sukari

      Product Claims

      This at-home chemical peel contains 25% AHA and 2% BHA and is a blend of glycolic, citric, lactic, tartaric and salicylic acids . All these acids work together to improve your skin texture, minimize pores, smooth fine lines, and improve the overall clarity of your skin.

    • No
    • No testosterone
    Rating [19659906] 4.8 / 5 [19659907] Buy it here

    pH-balanced

    9. Exuviance Performance Peel AP 25

     Exuviance Performance Peel AP 25

    Product Claims

    These high-performance glycolic acid peel pads contain a blend of 25% AHAs and PHAs (polyhydroxy acids). Apart from glycolic acid, these peel pads contain mandelic acid and gluconolactone. They refine the skin pore size, improve skin texture, brighten the skin, and make it soft.

  • PABA-free
  • Dye-free
  • Clinically tested (with positive results)
  • Pros
    • ] Cons
      • Contains methylparaben
      Rating

      4.8 / 5

      Buy it here! Natura Bisse Diamond Glyco Extreme Peel

       Product Claims

      This is a triple enzymatic exfoliation system containing 5 AHAs (glycolic, lactic, malic, citric, and tartaric acids). It provides deep exfoliation and dissolves the dead skin cells on the skin surface. It minimizes spots and blemishes and makes your skin radiant. 19650018] Cons [19659909]
    Rating

    4.7 / 5

    Buy it here!

    Remember, it is important to always be careful before experimenting with skin acids and chemical peels. Not all acids will suit your skin, and that's why a patch test is recommended. Chemical peels and skin acids increase the sun sensitivity of the skin, so using SPF and sun protection is non-negotiable. Also, if you are new to chemical exfoliation, it is better to consult a dermatologist and then go ahead with it.

    Tell us how helpful this article was for you. The Post 10 Best At-Home Chemical Peels To Try In 2019 appeared first on STYLECRAZE .

    101 “I Love You” Quotes To Express How You Feel

    101 “I Love You” Quotes To Express How You Feel


    George Sand said it right. "There is only one happiness in life. Love and be loved. "

    But you know what's very important to keep the love alive? Express it. Say it out loud. Sometimes, a simple 'I love you so much' can be enough. Sometimes, you need more!

    Looking for quotes to tell them how special they are to you? We've got you covered!

    101 Quotes To Say "I Love You"

    1. "The Hours I spend with you I look like a kind of a parfumed garden, a dim twilight , and a fountain singing to it. You and you alone make me feel that I am alive. "- George Moore
    1. " I seem to have loved you in countless forms, countless times, in life after life, in age after age forever . "- Rabindranath Tagore
    1. " A kiss, when all is said, what is it? A red dot placed on the "i" in love; "Edmond Rostand
    1. " Emily Bronte
    1. "The ultimate test of a relationship" "
    1. " Love is a promise, love is a souvenir, once given never forgotten, never let it disappear "- John Lennon
    1. " Love makes the wildest spirit tame , and the tamest spirit wild. "- Alexis Delp
    1. " Falling in love consists of uncorking the imagination and bottling the common sense "- Helen Rowland
    1. " When you love someone, just like he or she is, and not as you would like them to be. "- Leo Tolstoy
    1. " When you like someone, you like them despite their faults. When I Love Some, You Love It With Their Fouls. "- Elizabeth Cameron
     101 I Love You Quotes To Expression How You Feel

    Shutterstock

    1. " True Love Is Spelled G-I-V-E. "Josh McDowell
    1. " Love is something eternal; " "- Vincent Van Gogh
    1. " Love does not consist of gazing at each other but looking together in the same direction. "- Antoine de Saint-Exupery
    1. " Once you love, you can not take it back, can not undo it. "Whitney Otto
    1. " The quickest way to receive love is to give; the fastest way to lose love is to hold it too tightly; and the best way to keep love is to give it wings. "- Anonymous
    1. " All's fair in love and war. "- Francis Edwards
    1. " Love, like a river, will cut a new path whenever it meets the obstacle. "- Crystal Middlemas
    1. " If I had one more night to live, I would want to spend it with you. "- Pearl Harbor
    1. " When men and women are able to respect and accept their differences then love has a chance to blossom. "- Dr. John Gray
    1. "I Know You Love Me When You See The World In Her Eyes"

    1. "Love is strong yet delicate. It can be broken. It really is love to understand this. Stephen Packer
    1. "We sat in the morning light and looked out at the future together." – Brian Andres
    1. "Love is a canvas furnished by nature and embroidered by imagination. "- Francois Marie Arouet
    1. " Love is a symbol of eternity. It's all about the sense of time, destroying all the memory of the beginning and the fear of an end. "- Anonymous
    1. " The first duty of love – is to listen. "- Paul Tillich
    1. " The greatest weakness of most people are their hesitancy to tell others how much they love them while they're still alive. "- A. Battista
    1. " Love can never grow old. Locks may lose their brown and gold. Cheeks may fade and grow. "Leo Buscaglia
    1. " Elizabeth Bowen "- Elizabeth Bowen
    1. " When You Love Someone, All Your Saved Wishes Start Out ". ] "I never saw so sweet do it. That's what I stood before. I Claire
    1. "All That You Are Is It All I'll Ever Need" – Ed Sheeran
     101 I Love You Quotes To Express How You Feel3

    Shutterstock

    1. "I Love It, And That's The Beginning And The End Of Everything" by F. Scott Fitzgerald
    1. "Love recognizes no barriers." – Maya Angelou
    1. "- Johnny Updike
    1. " The heart has its reasons why not know anything. "- Blaise
    1. " We are most alive when we're in love " Pascal
    1. "Love is a Friendship That Has Captured Fire." – Ann Sanders
    1. "Albert Einstein
    1. " If you find someone you love in your life, "- Princess Diana
    1. " I fell in love with the way you fall asleep: slowly, and then all at once. " – John Green, The Fault in Our Stars
    1. "A simple" I love you "means more than money." – Frank Sinatra
     "I Love You Quotes To Expression How You Feel4

    Shutterstock [EverythingIDoIDoItForYou"-BryanAdams

    1. " … it's a blessed thing to love and feel loved in return. "- EA Bucchianeri
    1. "It's easy to fall in love. "Bertrand Russell
    1. " Love is like a mountain, hard to climb, but once you get to the top the view is beautiful. "- Daniel Monroe Tuttle
    1. " You "Meg Rogers
    1. " When I saw you I fell in love and you smiled because you knew. "- William Shakespeare
    1. " Love is not blind – It sees more and less, but because it sees it more is willing to see less. "- Will Moss
    1. " Love is an act of endless forgiveness, a tender look who gets a habit. "- Peter Ustinov
    1. " Anonymous
    1. "It's no sunshine when she's gone. It's not hot when she's away. (19659063) "You Deserve Love,

    1. " You Deserve Love, "" You Deserve Love, "" You Deserve Love, And you'll get it. "- Amy Poehler
    1. " I want you all, forever, you and me, every day. "- Nicholas Sparks, The Notebook
    1. (19659069) "There's nothing that, I do not want to live without you." – Winnie The Pooh
    1. Bob Dylan
    1. "Alfred, Lord Tennyson
    1. " To be brave is to be loved and lost, never to have loved at all. to love someone unconditionally, without expecting anything in return. "- Madonna
    1. " You know you are in love when you can not fall asleep because reality is fin ally better than your dreams. "- Dr. Seuss
    1. "I love being married. Rita Rudner
    1. "Audrey Hepburn
    1. "Rhett Butler, " Gone With The Wind
    1. "I like you very much. Just like you are. "- Bridget Jones's Diary
    1. " I love a great love story. "- Meghan Markle
    1. " Love is the flower; "- John Lennon
    1. " Maybe I do not know that much but I know this is true, I was blessed because I was loved by you. "- Celine Dion
    1. "When you realize you want to spend the rest of your life with someone, you want the rest of your life to start as soon as possible." – When Harry Met Sally
    1. "Love loves to love love." – James Joyce
    1. "Nobody has ever measured, not even poets, how much can the heart hold." – Zelda Fitzgerald
    1. "The love is an endless act of forgiveness." – Beyonce
    1. "The smile is the begin of love. "- Mother Teresa
     101 I Love You Quotes To Express How You Feel7

    Shutterstock

    1. " Some love stories are not epic novels. Some love are short stories, but that does not make them any less filled with love. "- Sex & The City
    1. " The Beatles
    1. "Love was made for me and you. "- Nat King Cole
    1. " I'd Never Lived Before Your Love ".- Kelly Clarkson
    1. " You Have Me At Hello! "- Jerry Maguire
    1. " True Love Stories Never Have Endings "- Richard Bach
    1. " Two Love Is True Love " things you will never have to chase: True friends & true love. "- Mandy Hale
    1. " True love will triumph in the end-which may or may not be a lie, but if it's a lie, it's the most beautiful I Love You "- John Green
     101 I Love You Quotes To Express How You Feel8

    Shutterstock

    1. " Dada Vaswani [1 9659102] True love is selfless. It is prepared to sacrifice. "- Sadhu Vaswani
    1. " True love is usually the most inconvenient kind. "- Kiera Cass
    1. " True love comes quietly, without banners or flashing lights. If you hear the bells, get your ears checked. "- Erich Segal
    1. " True love lasts forever. "- Joseph B. Wirthlin
    1. " True love, especially the first love, can be so tumultuous and passionate that it feels like a violent journey. "- Holliday Grainger
    1. " True love is eternal, infinite, and always like itself. It is equal and pure, without violent demonstrations: it is seen with white hairs and is always young in the heart. "- Honore de Balzac
    1. " True love brings up everything – you are allowing a mirror to be held up you daily. "- Billy Graham
    1. " True love does not happen right away; it's an ever-growing process. It develops after you have gone through many ups and downs, when you have suffered together, crying together, laughing together. "- Ricardo Montalban
    1. " William Shakespeare
    1. "- Torquato Tasso
    1. " I love a true love, and I'm a woman who wants to be married for a lifetime. That's what I want. "- Ali Larter
    1. " True love is inexhaustible; the more you give, the more you have. And if you go to draw on the true fountainhead, the more water you draw, the more abundant is its flow. "- Antoine de Saint-Exupery
    1. " True love, to me, when she's the first thought going through your head when you wake up and the last thought that goes through your head before you go to sleep. "- Justin Timberlake
    1. " Love is pure and true; love knows no gender. "- Tori Spelling
    1. " It may be true love when you let your other half be better, that's the person they're destined to be. "- Michelle Yeoh
    1. now that he was not close to her, but that he did not know where he ended and she started. "- Leo Tolstoy
    1. " You know, true love really matters, friends really matter, family really matters. Being responsible and disciplined and healthy really matters. "- Courtney Thorne-Smith
    1. " Only true love can fuel the hard work that awaits you. "- Tom Freston

    Which quote is your favorite from this compilation of quotes and sayings ? Is there any popular one we missed out? The Post 101 "I Love You" [19459202]

    7 Indian TV Celebrity Couples Who Had Grand Weddings Like Never Seen Before

    7 Indian TV Celebrity Couples Who Had Grand Weddings Like Never Seen Before


    Over the last decade, we certainly have to witness crazy big, big Indian weddings, especially from the showbiz world. We are talking not only about the town, but also about Bollywood's celebs here. We talk about the celebrities we see every day in the comfort of our homes on our TVs. Did you get a hint? We are talking about our favorite TV celebrities. Those who keep us every day of the fun and teach us some important moral lessons. While we carefully follow their roles on the screen and their whereabouts, we are also trying to keep up with our personal lives. And most of our favorite television stars are love, struck by another television star, and when they get married, it's a star-like affair.

    Here is a list of the wedding stories of several of them. The magnificence of their weddings will make you want them. Their wedding stories are nothing but fairy tales. Here, look at them.

    1. Ankita Bhargava And Karan Patel

    This beautiful couple tied the knot in 2015 on May 3rd. Their wedding was a highly anticipated event that their families and fans were eagerly looking forward to. They had made wedding ceremonies, such as the chicken party, the sang, the mehandi, the cocktail and the ringing ceremony. For the wedding, well, they had a wedding ceremony, followed by a spectacular wedding in Mumbai. All the biggies of the television industry welcomed their acceptance.

    2. Drashi and Niraj Hemka

       Dramas and Niragus Hemka

    Sanaiari / Instagram

    Drahes and Naraje tied the knot on February 21, 2015. of courtship, they finally decided to take marriage vows together. Their wedding was held at a hotel in Mumbai. The friends of Drasti from the television industry embraced the wedding and also the couple. Industry creams such as Karan Grover, Vivian Dsena, Nakuul Mehta and Sanaya Irani were some of the wedding guests. The wedding of Drašci was personal and even the wedding guest list was limited to relatives and dear ones.

    3. Sargun Mehta and Ravi Dabey

      Sargun Mehta and Ravi Dubey

    Sagunne and Ravi are considered to be one of the most abominable couples in the world of TV celebrities. The couple united in the marital bliss on December 7, 2013 in the hometown of Sargon, Chandigarh. Sargun was dressed as a beautiful panjabbish bride, while Ravie made him a royal king in a chariot. The wedding was followed by a grand reception. They even had a Buddhist wedding ceremony, as Ravi followed Buddhism as his religion.

    4. Nigar Han and Haiyam

      Nigarh Han and Haiyam

    Nigarhhan / Instagram

    Nigar Han will forever be known for the way he held the television screen while playing vamp. The older sister of Bollywood's famous Gawhar Khan, Nigar, married Hayam, a Pakistani businessman from Dubai, on July 23, 2015. In India, they had a ceremony of sanget and mehandi; this was followed by a wedding destination in Dubai. Both Hanzi sisters blinded all this wedding euphoria.

    5. Kishwer Merchant And Suyyash Rai

      kishwersmerchantt </a> </strong>  / <strong> Instagram </strong></p>
</div>
<p>  You can call them the most advanced couples because they have a whole web series from their wedding, their wedding was the most discussed for the 2016 affair in their wedding included a magnificent wedding before the wedding, the virgin party, the surrealistic photo session of the bridesmaid; not to forget their ceremonies, prone to the sea and the chaldees – this pair just hangs it! They tied the knot on December 16, 2016, and their magical wedding! </p>
<h2>  6. Sanctuary Irani And Mohit Sehgal </h2>
<div id=  Sanayi Irani And Mohit Sehgal

    Sanairai ” width=”500″ height=”650″ />

    Sanayi Irani And Mohit Sehgal ” width=”500″ height=”650″ />

    Sanayi Irani And Mohit Sehgal ” width=”500″ height=”650″ />

    . Both dogs from the land of the Tequila had a wedding ceremony in Goa on January 25, 2016. Their wedding had a splendid mood and many stars were present from the television world. Take a look at their wedding photos and you'll see that this is a big Indian Indian wedding.

    7. Diane Triphati and Vivek Dhaka

    The couple who rose to glory for the characters who played the super hit TV series Yeh Hai Mohabbatein became a fairy tale about the city on the television after the rumors of getting married began to make tours. They both walked on the path on July 8, 2016, and their wedding was a magnificent case. Even before the wedding celebrations to their great wedding, followed by a wedding party accompanied by stars, they both blinded. Their wedding was not just a memorable day for them, but also for their huge fan base.

    Pew … the list can go on and on, but we'll stop right here! And we just can not stop to laugh at their wedding photos. Have you been an avid follower of wedding weddings? What is your opinion about them? Share in the Comments section below.

    The Post 7 Indian TV celebrities who have had big weddings they have never seen before

    STYLECRAZE .

    Pyaar Kiya Toh Darna Kya: 27 Years Of LGBTQ Pride

    Pyaar Kiya Toh Darna Kya: 27 Years Of LGBTQ Pride


    Love does not know boundaries – this thought, albeit profoundly philosophical and poignant, is also removed from reality. For the world in which we live, this abstract idea of ​​love is fastened and managed by a cold, material reality. The reality of class, caste, religion and yes, also sex

    But the heart wants what he wants, right?

    June is celebrated as Pride in memory of the Stonewall riots that took place in New York, United States in June 1969. These riots arose from a spontaneous act of rebellion against the systematic harassment of gay members and the Lesbian police community. Until then, the LGBT community (lesbian, gay, bisexual, transgender) remains divided into factions and lives in relative ambiguity. But these rebellions helped them unite as a cohesive unit, and thus the active stream of LGBTQ activism (where Q stands for queer) was born. In many official and unofficial historical accounts of the LGBTQ movement, this moment is seen as one in which the gay and lesbian community acquires political identity ( 1 ).

    India By celebrating the end of the month of pride, let's take a look at the Indians who come out of the closet

    The Rainbow of India: Existing in the Imagination

    <img class = "wp-image-537705 size-full" src = "https: //cdn2.sty lecraze.com/wp-content/uploads/2019/06/Indias-Rainbow-Existing-In-The-Imaginative.jpg "alt =" Indian arc existing in imagination 19659009] rupinderkw_ / Instagram [19659005] From the early days of Indian society, ordinary Indian citizens identified as homosexuals or those who recognize them as existing tried to stay in the shade, but from time to time they would have dared to enter collective imagination by mentioning in books or in poetry.

    In 1942, the publication of the narrative of the Urdu writer Ismath Chhoty, Lihaaf led to a mischievous experience in which Chughtai was asked to apologize for portraying the relationship between two women as seen through the eyes of young girl ( 2 ). While eventually winning the case, the story made her (not) known as a provocative writer of corrupt books. Instagram

    Since then, until the early 1990s, several bold writers have been trying to describe homosexuality, but society has generally been embarrassed to talk about the problem, calling it immoral and corrupt ( 3 ).

    Instagram

    The Stonewall Indian moment came almost two decades after the original, On August 11, 1992 The discovery of the toilet [severalprotestersfromanorganizationcalled AIDS Bhddhaw Virohi Andolan decided to block the entrance of the police headquarters in Delhi to protest the arrest of several men on suspicion of homosexuality 4 ).

    The organization also laid the foundation for the annulment of the outdated Section 377, which punishes anyone who has had a voluntary bodily contact against the human order. with every man, woman or animal.

    This law was not only used as a tool to suppress and terrorize members of the LGBTQ community, but its archaic expression also made some sexual acts between the consent of heteronomic couples as illegal! Needless to say, there was no place in modern India.

    In 2001, NGO Naz Foundation filed a public interest lawsuit (PIL) at the Delhi Supreme Court to make homosexual intercourse . After a lengthy legal battle of eight years, in 2009 the Delhi Supreme Court decriminalized homosexual acts, defining Article 377 as violating the fundamental rights set out in the Constitution, but that decision was revoked by the Supreme Court in 2013 ( 5 ). Finally, after a series of conversations and debates on the constitutionality of the law, the Supreme Court finally legalized homosexual acts by partially hitting section 377 in September 2018 . Although the merit of this remarkable victory goes to these foundations, and several prominent private citizens who mobilized support to fight a good fight, one can boast of them. [19599006] [19599006] / 19459005 Do not ignore those countless ordinary individuals who fight for moral police and contempt for society by participating in the freedom marches and pride parades. The first pride parade in India was held in Kolkata in 1999, when 15 LGBTK activists took part in the (19459014) 7 ). This tradition is perceived by other cities in the country that have recently hosted their own parades.

    Eliminating Article 377: Towards a More Inclusive Future

      Eliminating Article 377 towards a more inclusive future

    ] Although neighbors like Taiwan have taken more radical steps such as legalization of same-sex marriages, India is still testing the waters. But one thing is certain that the change comes and for many members of the LGBTQ community there is an arc at the end of the tunnel.

    This can be seen from the fact that public figures such as the athlete Duttee Chand had no suppression of the declaration of their sexual orientation to the world. And why, when she had such a strong community to support her (19459037) 8 .

    More and more acceptance becomes a norm. It is true that society is afraid of what it does not understand, and now, Indian society is trying to understand its very costly faction. The stories of individuals who are accepted by their families who are encouraged to be irreconcilable are increasing. Social media projects such as The people of Bombay are full of them.

    It would not be right to say that everyone is free to love in this after 377 India, but yes they are no longer considered criminals because they love someone of the same sex. So, yes, with every passing day, India certainly is, but surely goes out of the closet. ] STYLECRAZE .

    10 TV Actresses To Follow For Saree Fashion Inspiration

    10 TV Actresses To Follow For Saree Fashion Inspiration


    Sari is an integral part of Indian television, especially serials which are hot favorites. In fact, more than movies, these TV series and everyday soaps give us #sareegoals. These television actresses admire the small screen with their different styles of sari. One can see how sari can be worn throughout the day, be it while he's making breakfast for the laws, or spying bahu . Sari is a beautiful garment that can be shaped in countless ways. TV actresses show us some of the best sari styles with their designer sari and carefree grace. Not only are their screen appearances captivated by them, but their sars look beyond the screen.

    Here is a list of 10 television actresses who give us serious goals for sari –

    1. Mooney Roy

      Mooney Roy

    imouniroy / Instagram

    Mooney Roy is one of those television actresses who also became popular in Bollywood. And why not? Her acting is at the top and it looks no less than an angel. The sense of style is quite amazing and is definitely on top of the stylish game with a careful combination of Indo-Western clothes. Sari is something she looks very elegant for her, not only because she is beautiful but also because of the sense of style. Typically, her sari are single-colored, without much embellishment. But her blouses are heavy and sophisticated.

    2. Karisma Thana [19650010] Karismaktanna / Instagram

    The tall and beautiful maiden, Karisma Tana is highly rated for the fashion radar when it comes to a small screen. By Big Boss 8 for rewarding night glances, she has always maintained a living sari. Her high, dry figure complements the Indian garment. She is captured to bring bold and stylish sars, as well as those that give us a traditional atmosphere.

    3. Sumona Chakravarti

    The television star is popular for his performances in the nation's most popular comedy show. ] And she leaves us hearty eyes every time she's noticed to wear sari. Sweet actress is an expert in the successful pulling of fine sari. It most often carries sarajeta with regular borders, Satta satin that are embroidered, and super hot nets. Sometimes it seems to be exactly from Karan Johar's film without sarson ki khet . The actress also likes to experiment with the design of her blouse. From sleeves up to 3/4 sleeves with pearl borders, she has tried them out. So, if you're looking for a satirical stylist, the Sumona collection is all you need to look at.

    4. Hina Khan

    Favorite Hindu actress Hinna Khan boasts her western outfit at Cannes this year and won the hearts of critics of the red carpet But it is clear that she has not forgotten love you are to the Saris. It is a perfect example for someone who keeps traditional and western clothes. Hina's performances on the screen began with her debut television series Yeh Risha Kia Kehta Hai in which she played the role of Akshara. Her sara and other outfits are so popular that you can now buy them online under the Akshara Dress Collection brand!

    5. Divyanka Tripathi

    Divyanka is undoubtedly one of the most beautiful actresses in the television world. Her super-hit TV series Mohabbetein in which she played the role of Ishita, gathered a huge fan base. Diwikka always looked stunning in her sara, and mostly she wears brightly colored, contrasting blouses that stand out and complement her body and face. Playing her role, a Punjabi wife and a South Indian daughter, she shows a good combination of both styles.

    6. Krsytle D'Souza

    The magnificent Krystle is known not only for acting but also for its incredible costumes. In the television series she's been working on, her sara seems to have always been pretty simple. However, when she walks along the red carpet she looks completely different with refined and stylish clothes and hairstyles. It is more oriented towards modern sars than to traditional ones in real life.

    7. Surbhi Jyoti

    The Sars of Surbhi Jyoti admire their simplicity. Actress is good at keeping your clothes and makeup simple. This is why it seems breathtaking in everything it carries. She likes to experiment with her sara looking by blending modern and ethnic elements. Who would not like the best of the two worlds, right? Anita Hassanandani

    Anita is a very beautiful and popular person in the television industry for years. She is one of those actresses who started her acting career on the small screen pretty early and still stand strong. She has a huge number of followers on social media platforms like Instagram, where she points out her hot sari. More than ethnic styles, Anita likes to experiment with different sari styles, which is very obvious from her posts at Instagram.

    9. Instagram

    We saw Devil in all sorts of traditional sara when she was on the screen playing Gopi in . ” width=”500″ height=”650″ />

    Devoleena Bhattacharjee ” width=”500″ height=”650″ />

    devoleena [NomatterhowdivineitlookedintraditionalclotheswelovehercompletelywhenshegivesheralittlemoderntouchasshowninthepictureaboveHerlong-sleevedblouseisagreattrendamongstherfansandtheydowellwiththesariofallthefabrics

    10. Shama Sikander

      Shama Sikander

    shamasikander / Instagram

    Shama Sikander is another little actress on the screen that has been around for quite some time. The actress who was popular as a leading actress in the television series Yeh Meri Life Hai took a long time to rest. Now she returns to a glamorous avatar that makes the Sarah lovers take pictures of her pictures!

    Sari is eternal clothing and no matter how much we wear western clothing, every Indian girl has a soft corner for sari. agree on this? Who do you think is the best-acting TV actress when it comes to sary? Let him know in the comments below. The post 10 television actresses to follow for Saree Fashion Inspiration appeared first on STYLECRAZE .